General Information

  • ID:  hor004667
  • Uniprot ID:  Q3ECH9
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 18
  • Gene name:  CLE18
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE18p]: Expressed in roots, leaves, siliques and seedlings.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0009786 regulation of asymmetric cell division; GO:0010078 maintenance of root meristem identity; GO:0010082 regulation of root meristem growth; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation; GO:2000023 regulation of lateral root development; GO:2000067 regulation of root morphogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  IREDPSLIGVDRQIPTGPDPLHNPPQPSPKHHHWIGVEENNIDRSWNYVDYESHHAHSPIHNSPEPAPLYRHLIGV
  • Length:  76
  • Propeptide:  MHLLKGGVVLIITLILFLITSSIVAIREDPSLIGVDRQIPTGPDPLHNPPQPSPKHHHWIGVEENNIDRSWNYVDYESHHAHSPIHNSPEPAPLYRHLIGV
  • Signal peptide:  MHLLKGGVVLIITLILFLITSSIVA
  • Modification:  T15 Hydroxyproline;T18 Hydroxyproline;T51 Sulfotyrosine;T59 Hydroxyproline
  • Glycosylation:  T18 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q3ECH9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004667_AF2.pdbhor004667_ESM.pdb

Physical Information

Mass: 1005352 Formula: C390H578N116O114
Absent amino acids: CFM Common amino acids: P
pI: 6.41 Basic residues: 14
Polar residues: 19 Hydrophobic residues: 19
Hydrophobicity: -98.82 Boman Index: -17017
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 74.34
Instability Index: 7160.39 Extinction Coefficient cystines: 15470
Absorbance 280nm: 206.27

Literature

  • PubMed ID:  NA
  • Title:  NA